IL 6 Human, CHO
目录号 : GP20515Interleukin-6 Recombinant Human, CHO
Purity | Greater than 95.0% as determined by analysis by SDS-PAGE. | Source | Chinese Hamster Ovarian Cells. |
Phycical Appearance | Sterile filtered colorless solution. | Shipping Condition | Shipped with Ice Packs. |
Synonyms | IFN-b2; B cell differentiation factor; BCDF; BSF-2; HPGF; HSF; MGI-2; B-cell stimulatory factor 2; Interferon beta-2; Hybridoma growth factor; CTL differentiation factor; CDF; IL-6; HGF. | ||
Amino Acid Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN | ||
Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. | ||
Biological Activity | ED50 < 1 ng/ml. The activity was determined by the dose dependent stimulation of the proliferation of human TF-1 cells (human erythroleukemic indicator cell line). | ||
Formulation | IL-6 is a sterile filtered (0.22µm) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2. |
IL-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes it induces acute phase reactants.
ED50 < 1 ng/ml. The activity was determined by the dose dependent stimulation of the proliferation of human TF-1 cells (human erythroleukemic indicator cell line).
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.